PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G138300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 290aa    MW: 32041.1 Da    PI: 6.18
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G138300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-092202532255
                         SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          +yp+++++ +LA+ +gL+ +q+ +WF N+R ++
  Brast08G138300.1.p 220 WPYPTEDDKVRLAAMTGLDPKQINNWFINQRKRH 253
                         59*****************************885 PP

2ELK34.83.5e-12173194122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK++Ll+KYsg+L+ L++EF+
  Brast08G138300.1.p 173 ELKEMLLKKYSGCLSRLRSEFM 194
                         9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.5E-193478IPR005540KNOX1
PfamPF037907.5E-203775IPR005540KNOX1
SMARTSM012564.6E-2583134IPR005541KNOX2
PfamPF037911.9E-2287133IPR005541KNOX2
PROSITE profilePS5121310.423173193IPR005539ELK domain
SMARTSM011887.9E-7173194IPR005539ELK domain
PfamPF037893.9E-9173194IPR005539ELK domain
PROSITE profilePS5007112.487193256IPR001356Homeobox domain
SuperFamilySSF466899.84E-20195263IPR009057Homeodomain-like
SMARTSM003894.5E-14195260IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-26198258IPR009057Homeodomain-like
CDDcd000867.78E-13205257No hitNo description
PfamPF059201.2E-16213252IPR008422Homeobox KN domain
PROSITE patternPS000270231254IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MEDLYSIHPG ISRGGAACSE ASGVAGGSPP PPPDLTKAQI AAHPRYPSLL SAYIECRKVG  60
APPDVAALLE EMSRDRERRR PGAAGEIGLD PELDEFMEAY CRVLWRYKEE LSRPLDEAAS  120
FLATVRTQLS SLCGATSHSD EFVGSSEDEP CSGDGDASEV GMQEHTSRLA DHELKEMLLK  180
KYSGCLSRLR SEFMKKRKKG KLPKDARLAL MDWWNTHYRW PYPTEDDKVR LAAMTGLDPK  240
QINNWFINQR KRHWKPSEDM RFALMEGVNG GGGSSSGTTL YFDTGTIGP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188197LRSEFMKKRK
2194198KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2486000.0AK248600.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf126d22, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569063.11e-179PREDICTED: homeobox protein knotted-1-like 10
SwissprotQ9FP291e-141KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLI1HMP81e-179I1HMP8_BRADI; Uncharacterized protein
STRINGBRADI2G38390.11e-179(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-83KNOTTED1-like homeobox gene 6